Lineage for d1pg5b2 (1pg5 B:105-160)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706247Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1706248Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1706249Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 1706386Species Sulfolobus acidocaldarius [TaxId:2285] [111453] (2 PDB entries)
  8. 1706387Domain d1pg5b2: 1pg5 B:105-160 [104149]
    Other proteins in same PDB: d1pg5a1, d1pg5a2, d1pg5b1
    complexed with zn

Details for d1pg5b2

PDB Entry: 1pg5 (more details), 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1pg5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg5b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Sulfolobus acidocaldarius [TaxId: 2285]}
kvvkgilkcpnpycitsndveaiptfktltekplkmrceycetiideneimsqilg

SCOPe Domain Coordinates for d1pg5b2:

Click to download the PDB-style file with coordinates for d1pg5b2.
(The format of our PDB-style files is described here.)

Timeline for d1pg5b2:

1706387
d1pg5b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1pg5b1