Lineage for d1nrva_ (1nrv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1424781Protein Growth factor receptor-bound protein 10, GRB10 [89994] (1 species)
  7. 1424782Species Human (Homo sapiens) [TaxId:9606] [89995] (1 PDB entry)
  8. 1424783Domain d1nrva_: 1nrv A: [86126]

Details for d1nrva_

PDB Entry: 1nrv (more details), 1.65 Å

PDB Description: Crystal structure of the SH2 domain of Grb10
PDB Compounds: (A:) Growth factor receptor-bound protein 10

SCOPe Domain Sequences for d1nrva_:

Sequence, based on SEQRES records: (download)

>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]}
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ceddgqtffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcir

Sequence, based on observed residues (ATOM records): (download)

>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]}
ihrtqhwfhgrisreeshriikqqglvdglfllrdsqsnpkafvltlchhqkiknfqilp
ctffslddgntkfsdliqlvdfyqlnkgvlpcklkhhcir

SCOPe Domain Coordinates for d1nrva_:

Click to download the PDB-style file with coordinates for d1nrva_.
(The format of our PDB-style files is described here.)

Timeline for d1nrva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrvb_