Lineage for d1n1ba1 (1n1b A:64-270)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
incomplete toroid made of four hairpins
automatically mapped to Pfam PF01397Protein (+)-bornyl diphosphate synthase [81857] (1 species) Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries) 
Domain d1n1ba1: 1n1b A:64-270 [79799]
Other proteins in same PDB: d1n1ba2, d1n1bb2
complexed with hg, mg
Details for d1n1ba1
PDB Entry: 1n1b (more details), 2 Å
PDB Description: crystal structure of (+)-bornyl diphosphate synthase from sage
PDB Compounds: (A:) (+)-bornyl diphosphate synthaseSCOPe Domain Sequences for d1n1ba1:
Sequence, based on SEQRES records: (download)
>d1n1ba1 a.102.4.1 (A:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidf
kaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllwirh
sldlplhwriqsvearwfidayarrpd
Sequence, based on observed residues (ATOM records): (download)
>d1n1ba1 a.102.4.1 (A:64-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
lwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffq
deikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidf
kaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkklddenlllwirhsldlpl
hwriqsvearwfidayarrpd
SCOPe Domain Coordinates for d1n1ba1:
Click to download the PDB-style file with coordinates for d1n1ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n1ba1:
- d1n1ba1 first appeared in SCOP 1.63
- d1n1ba1 appears in SCOPe 2.03
- d1n1ba1 appears in SCOPe 2.05
- d1n1ba1 appears in the current release, SCOPe 2.08
View in 3D
