Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Cruzain [54020] (1 species) |
Species Trypanosoma cruzi [TaxId:5693] [54021] (20 PDB entries) |
Domain d1me4a_: 1me4 A: [79023] complexed with t10 |
PDB Entry: 1me4 (more details), 1.2 Å
SCOPe Domain Sequences for d1me4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii knswttqwgeegyiriakgsnqclvkeeassavvg
Timeline for d1me4a_: