Lineage for d1lvfb_ (1lvf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327609Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2327627Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2327628Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2327642Protein Syntaxin 6, SNAP-25 homolog [74727] (1 species)
  7. 2327643Species Norway rat (Rattus norvegicus) [TaxId:10116] [74728] (1 PDB entry)
  8. 2327645Domain d1lvfb_: 1lvf B: [74281]
    three-helical fragment; similar to one spectrin repeat

Details for d1lvfb_

PDB Entry: 1lvf (more details), 2.1 Å

PDB Description: syntaxin 6
PDB Compounds: (B:) syntaxin 6

SCOPe Domain Sequences for d1lvfb_:

Sequence, based on SEQRES records: (download)

>d1lvfb_ a.47.2.1 (B:) Syntaxin 6, SNAP-25 homolog {Norway rat (Rattus norvegicus) [TaxId: 10116]}
medpffvvkgevqkavntaqglfqrwtellqgpsaatreeidwttnelrnnlrsiewdle
dldetisiveanprkfnldatelsirkafitstrqivrdmkdqmsass

Sequence, based on observed residues (ATOM records): (download)

>d1lvfb_ a.47.2.1 (B:) Syntaxin 6, SNAP-25 homolog {Norway rat (Rattus norvegicus) [TaxId: 10116]}
medpffvvkgevqkavntaqglfqrwtellqgpsaatreeidwttnelrnnlrsiewdle
dldetisiveannldatelsirkafitstrqivrdmkdqmsass

SCOPe Domain Coordinates for d1lvfb_:

Click to download the PDB-style file with coordinates for d1lvfb_.
(The format of our PDB-style files is described here.)

Timeline for d1lvfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lvfa_