Lineage for d1l2ta_ (1l2t A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
there are two additional subdomains inserted into the central core that has a RecA-like topology
Protein MJ0796 [64027] (1 species) Species Methanococcus jannaschii [TaxId:2190] [64028] (2 PDB entries) 
Domain d1l2ta_: 1l2t A: [73514]
complexed with atp, ipa, na
Details for d1l2ta_
PDB Entry: 1l2t (more details), 1.9 Å
PDB Description: dimeric structure of mj0796, a bacterial abc transporter cassette
PDB Compounds: (A:) hypothetical abc transporter ATP-binding protein mj0796SCOPe Domain Sequences for d1l2ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Methanococcus jannaschii [TaxId: 2190]}
miklknvtktykmgeeiiyalknvnlnikegefvsimgpsgsgkstmlniigcldkpteg
evyidniktndldddeltkirrdkigfvfqqfnliplltalenvelplifkyrgamsgee
rrkraleclkmaeleerfanhkpnqlsggqqqrvaiaralannppiiladqptgaldskt
gekimqllkklneedgktvvvvthdinvarfgeriiylkdgevereeklr
SCOPe Domain Coordinates for d1l2ta_:
Click to download the PDB-style file with coordinates for d1l2ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l2ta_:
- d1l2ta_ first appeared in SCOP 1.61
- d1l2ta_ appears in SCOPe 2.02
- d1l2ta_ appears in SCOPe 2.04
- d1l2ta_ appears in the current release, SCOPe 2.08
View in 3D
