Lineage for d1ky9b1 (1ky9 B:260-358)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312534Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 1312538Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
    duplication: tandem repeat of two PDZ domains
  7. 1312539Species Escherichia coli [TaxId:562] [74935] (3 PDB entries)
  8. 1312543Domain d1ky9b1: 1ky9 B:260-358 [73200]
    Other proteins in same PDB: d1ky9a2, d1ky9b3

Details for d1ky9b1

PDB Entry: 1ky9 (more details), 2.8 Å

PDB Description: crystal structure of degp (htra)
PDB Compounds: (B:) Protease do

SCOPe Domain Sequences for d1ky9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky9b1 b.36.1.4 (B:260-358) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss

SCOPe Domain Coordinates for d1ky9b1:

Click to download the PDB-style file with coordinates for d1ky9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ky9b1: