Class a: All alpha proteins [46456] (285 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
Domain d1kjya1: 1kjy A:61-181 [72624] Other proteins in same PDB: d1kjya2, d1kjyc2 bound to the goloco motif of rgs14, chains B and D complexed with cs, gdp, mg |
PDB Entry: 1kjy (more details), 2.7 Å
SCOPe Domain Sequences for d1kjya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjya1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d1kjya1: