Lineage for d1kioa_ (1kio A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1460607Fold g.4: PMP inhibitors [57282] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 1460608Superfamily g.4.1: PMP inhibitors [57283] (1 family) (S)
    automatically mapped to Pfam PF05375
  5. 1460609Family g.4.1.1: PMP inhibitors [57284] (5 proteins)
  6. 1460619Protein Protease inhibitor SGCI [69945] (1 species)
  7. 1460620Species Desert locust (Schistocerca gregaria) [TaxId:7010] [69946] (2 PDB entries)
  8. 1460621Domain d1kioa_: 1kio A: [68633]

Details for d1kioa_

PDB Entry: 1kio (more details)

PDB Description: solution structure of the small serine protease inhibitor sgci[l30r, k31m]
PDB Compounds: (A:) serine protease inhibitor I

SCOPe Domain Sequences for d1kioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kioa_ g.4.1.1 (A:) Protease inhibitor SGCI {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
evtcepgttfkdkcntcrcgsdgksaactrmacpq

SCOPe Domain Coordinates for d1kioa_:

Click to download the PDB-style file with coordinates for d1kioa_.
(The format of our PDB-style files is described here.)

Timeline for d1kioa_: