Class g: Small proteins [56992] (91 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries) Uniprot P15692 40-133 |
Domain d1katv_: 1kat V: [77309] complexed with a phage-derived peptide antagonist, chains X and Y |
PDB Entry: 1kat (more details)
SCOPe Domain Sequences for d1katv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1katv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
Timeline for d1katv_: