Lineage for d1jxva_ (1jxv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415052Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 1415145Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries)
  8. 1415152Domain d1jxva_: 1jxv A: [71932]

Details for d1jxva_

PDB Entry: 1jxv (more details), 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A
PDB Compounds: (A:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d1jxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxva_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d1jxva_:

Click to download the PDB-style file with coordinates for d1jxva_.
(The format of our PDB-style files is described here.)

Timeline for d1jxva_: