Lineage for d1j2ea1 (1j2e A:38-508)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327543Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1327637Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 1327638Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 1327645Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 1327646Species Human (Homo sapiens) [TaxId:9606] [82174] (68 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1327779Domain d1j2ea1: 1j2e A:38-508 [90781]
    Other proteins in same PDB: d1j2ea2, d1j2eb2
    complexed with nag

Details for d1j2ea1

PDB Entry: 1j2e (more details), 2.6 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1j2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ea1 b.70.3.1 (A:38-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfde
fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d1j2ea1:

Click to download the PDB-style file with coordinates for d1j2ea1.
(The format of our PDB-style files is described here.)

Timeline for d1j2ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j2ea2