Lineage for d1iznb_ (1izn B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1695098Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
    3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha
  4. 1695099Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) (S)
  5. 1695114Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins)
    automatically mapped to Pfam PF01115
  6. 1695115Protein Capz beta-1 subunit [90101] (1 species)
  7. 1695116Species Chicken (Gallus gallus) [TaxId:9031] [90102] (6 PDB entries)
  8. 1695119Domain d1iznb_: 1izn B: [83848]
    Other proteins in same PDB: d1izna_, d1iznc_
    domain boundaries: B:2-46;47-88;89-271, D:2-46;47-88;89-271
    complexed with no3

Details for d1iznb_

PDB Entry: 1izn (more details), 2.1 Å

PDB Description: Crystal Structure of Actin Filament Capping Protein CapZ
PDB Compounds: (B:) CapZ beta-1 subunit

SCOPe Domain Sequences for d1iznb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iznb_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll
cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl
wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk
tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn
glrsidaipdnqkykqlqrelsqvltqrqi

SCOPe Domain Coordinates for d1iznb_:

Click to download the PDB-style file with coordinates for d1iznb_.
(The format of our PDB-style files is described here.)

Timeline for d1iznb_: