Lineage for d1ihfa_ (1ihf A:)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
core: 4 helices; bundle, partly opened, capped with a beta-sheetSuperfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) 
dimer of identical subunitsFamily a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) 
Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
heterodimer of two related subunitsSpecies Escherichia coli [TaxId:562] [88879] (5 PDB entries) 
Domain d1ihfa_: 1ihf A: [17893]
Other proteins in same PDB: d1ihfb_
protein/DNA complex; complexed with cd
Details for d1ihfa_
PDB Entry: 1ihf (more details), 2.2 Å
PDB Description: integration host factor/dna complex
PDB Compounds: (A:) protein (integration host factor (alpha) (ihf))SCOP Domain Sequences for d1ihfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk
SCOP Domain Coordinates for d1ihfa_:
Click to download the PDB-style file with coordinates for d1ihfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihfa_:
- d1ihfa_ first appeared (with stable ids) in SCOP 1.55
- d1ihfa_ appears in SCOP 1.73
- d1ihfa_ appears in SCOPe 2.01
- d1ihfa_ appears in the current release, SCOPe 2.08
View in 3D
