Lineage for d1hvqa_ (1hvq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340862Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 1340863Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 1340870Domain d1hvqa_: 1hvq A: [28987]

Details for d1hvqa_

PDB Entry: 1hvq (more details), 2.2 Å

PDB Description: crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor
PDB Compounds: (A:) hevamine a

SCOPe Domain Sequences for d1hvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvqa_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOPe Domain Coordinates for d1hvqa_:

Click to download the PDB-style file with coordinates for d1hvqa_.
(The format of our PDB-style files is described here.)

Timeline for d1hvqa_: