![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
![]() | Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species) includes parts of the flanking linkers |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54276] (77 PDB entries) |
![]() | Domain d1he8a3: 1he8 A:144-321 [37637] Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a4, d1he8b_ complexed with gnp, mg |
PDB Entry: 1he8 (more details), 3 Å
SCOPe Domain Sequences for d1he8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he8a3 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]} seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke
Timeline for d1he8a3: