Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) |
Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
Protein alpha-actinin [46971] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46972] (3 PDB entries) |
Domain d1hcia1: 1hci A:272-396 [60950] the rod domain: homodimer of four-repeat fragments |
PDB Entry: 1hci (more details), 2.8 Å
SCOPe Domain Sequences for d1hcia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} ssavnqenerlmeeyerlasellewirrtipwlenrtpektmqamqkkledfrdyrrkhk ppkvqekcqleinfntlqtklrisnrpafmpsegkmvsdiagawqrleqaekgyeewlln eirrl
Timeline for d1hcia1:
View in 3D Domains from other chains: (mouse over for more information) d1hcib1, d1hcib2, d1hcib3, d1hcib4 |