Lineage for d1h6ua1 (1h6u A:263-343)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300116Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 1300134Protein Internalin H [69174] (1 species)
  7. 1300135Species Listeria monocytogenes [TaxId:1639] [69175] (1 PDB entry)
  8. 1300136Domain d1h6ua1: 1h6u A:263-343 [65688]
    Other proteins in same PDB: d1h6ua2

Details for d1h6ua1

PDB Entry: 1h6u (more details), 1.8 Å

PDB Description: internalin h: crystal structure of fused n-terminal domains.
PDB Compounds: (A:) internalin h

SCOPe Domain Sequences for d1h6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ua1 b.1.18.15 (A:263-343) Internalin H {Listeria monocytogenes [TaxId: 1639]}
titnqpvfynnnlvvpnvvkgpsgapiapatisdngtyaspnltwnltsfinnvsytfnq
svtfknttvpfsgtvtqplte

SCOPe Domain Coordinates for d1h6ua1:

Click to download the PDB-style file with coordinates for d1h6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ua2