Lineage for d1gwib_ (1gwi B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein Cyp154c1 monooxygenase [81867] (1 species)
functionalizes macrolide ring systemsSpecies Streptomyces coelicolor [TaxId:1902] [81868] (1 PDB entry) 
Domain d1gwib_: 1gwi B: [76365]
complexed with hem, so4
Details for d1gwib_
PDB Entry: 1gwi (more details), 1.92 Å
PDB Description: the 1.92 a structure of streptomyces coelicolor a3(2) cyp154c1: a new monooxygenase that functionalizes macrolide ring systems
PDB Compounds: (B:) cytochrome p450 154c1SCOPe Domain Sequences for d1gwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwib_ a.104.1.1 (B:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}
aripldpfvtdldgesarlraagplaavelpggvpvwavthhaeakalltdprlvkdinv
wgawrrgeipadwpliglanpgrsmltvdgaehrrlrtlvaqaltvrrvehmrgritelt
drlldelpadggvvdlkaafayplpmyvvadlmgieearlprlkvlfekffstqtppeev
vatltelasimtdtvaakraapgddltsaliqasengdhltdaeivstlqlmvaaghett
islivnavvnlsthpeqralvlsgeaewsavveetlrfstptshvlirfaaedvpvgdrv
ipagdalivsygalgrderahgptadrfdltrtsgnrhisfghgphvcpgaalsrmeagv
alpalyarfphldlavpaaelrnkpvvtqndlfelpvrlah
SCOPe Domain Coordinates for d1gwib_:
Click to download the PDB-style file with coordinates for d1gwib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gwib_:
- d1gwib_ first appeared in SCOP 1.63
- d1gwib_ appears in SCOPe 2.06
- d1gwib_ appears in the current release, SCOPe 2.08
View in 3D
