Lineage for d1gvra_ (1gvr A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436916Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 2436917Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries)
    Uniprot P71278
  8. 2436931Domain d1gvra_: 1gvr A: [83339]
    complexed with fmn, tnl

Details for d1gvra_

PDB Entry: 1gvr (more details), 1.38 Å

PDB Description: structure of pentaerythritol tetranitrate reductase and complexed with 2,4,6 trinitrotoluene
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d1gvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

SCOPe Domain Coordinates for d1gvra_:

Click to download the PDB-style file with coordinates for d1gvra_.
(The format of our PDB-style files is described here.)

Timeline for d1gvra_: