Lineage for d1gqza2 (1gqz A:131-274)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
automatically mapped to Pfam PF01678Protein Diaminopimelate epimerase [54508] (2 species) Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries) 
Domain d1gqza2: 1gqz A:131-274 [83312]
Details for d1gqza2
PDB Entry: 1gqz (more details), 1.75 Å
PDB Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a
PDB Compounds: (A:) Diaminopimelate epimeraseSCOPe Domain Sequences for d1gqza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl
SCOPe Domain Coordinates for d1gqza2:
Click to download the PDB-style file with coordinates for d1gqza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gqza2:
- d1gqza2 first appeared in SCOP 1.65
- d1gqza2 appears in SCOPe 2.02
- d1gqza2 appears in SCOPe 2.04
- d1gqza2 appears in the current release, SCOPe 2.08
View in 3D
