Lineage for d1g9ng_ (1g9n G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608993Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2608994Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2608995Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2608996Protein gp120 core [56504] (3 species)
  7. 2608999Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 2609018Domain d1g9ng_: 1g9n G: [42494]
    Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2
    complexed with nag, ndg

Details for d1g9ng_

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (G:) envelope glycoprotein gp120

SCOPe Domain Sequences for d1g9ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ng_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

SCOPe Domain Coordinates for d1g9ng_:

Click to download the PDB-style file with coordinates for d1g9ng_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ng_: