Lineage for d1fjma_ (1fjm A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) 
Protein Protein phosphatase-1 (PP-1) [56311] (5 species) 
Species Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId:9986] [56312] (1 PDB entry) 
Domain d1fjma_: 1fjm A: [42082]
complexed with bme, mn
Details for d1fjma_
PDB Entry: 1fjm (more details), 2.1 Å
PDB Description: Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-LR toxin
PDB Compounds: (A:) protein serine/threonine phosphatase-1 (alpha isoform, type 1)SCOPe Domain Sequences for d1fjma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjma_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId: 9986]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
SCOPe Domain Coordinates for d1fjma_:
Click to download the PDB-style file with coordinates for d1fjma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fjma_:
- d1fjma_ first appeared (with stable ids) in SCOP 1.55
- d1fjma_ appears in SCOPe 2.02
- d1fjma_ appears in SCOPe 2.04
- d1fjma_ appears in the current release, SCOPe 2.08
View in 3D
