Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Protein phosphatase-1 (PP-1) [56311] (5 species) |
Species Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId:9986] [56312] (1 PDB entry) |
Domain d1fjma_: 1fjm A: [42082] complexed with bme, mn |
PDB Entry: 1fjm (more details), 2.1 Å
SCOPe Domain Sequences for d1fjma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjma_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId: 9986]} lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
Timeline for d1fjma_: