Lineage for d1fiqa2 (1fiq A:2-92)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403347Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1403465Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 1403466Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 1403485Domain d1fiqa2: 1fiq A:2-92 [37697]
    Other proteins in same PDB: d1fiqa1, d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2
    complexed with fad, fes, gol, mos, mte, sal

Details for d1fiqa2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk
PDB Compounds: (A:) xanthine oxidase

SCOPe Domain Sequences for d1fiqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqa2 d.15.4.2 (A:2-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d1fiqa2:

Click to download the PDB-style file with coordinates for d1fiqa2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqa2:

1403485
d1fiqa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fiqa1