Lineage for d1f0ma_ (1f0m A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272220Protein EphB2 receptor [47776] (2 species)
  7. 1272223Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 1272232Domain d1f0ma_: 1f0m A: [17942]

Details for d1f0ma_

PDB Entry: 1f0m (more details), 2.2 Å

PDB Description: monomeric structure of the human ephb2 sam (sterile alpha motif) domain
PDB Compounds: (A:) ephrin type-b receptor 2

SCOPe Domain Sequences for d1f0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0ma_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}
ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsi
qvmraqmnqiq

SCOPe Domain Coordinates for d1f0ma_:

Click to download the PDB-style file with coordinates for d1f0ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f0ma_: