Lineage for d1ez3a_ (1ez3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327609Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2327627Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2327628Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2327632Protein Syntaxin 1A N-terminal domain [47663] (2 species)
  7. 2327636Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries)
  8. 2327637Domain d1ez3a_: 1ez3 A: [17768]
    three-helical fragment; similar to one spectrin repeat

Details for d1ez3a_

PDB Entry: 1ez3 (more details), 1.9 Å

PDB Description: crystal structure of the neuronal t-snare syntaxin-1a
PDB Compounds: (A:) syntaxin-1a

SCOPe Domain Sequences for d1ez3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkt
ankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerc
kgri

SCOPe Domain Coordinates for d1ez3a_:

Click to download the PDB-style file with coordinates for d1ez3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ez3a_: