Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Sialidase, "linker" domain [49237] (1 species) follows the catalytic six-bladed beta-propeller domain |
Species Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries) |
Domain d1eut_1: 1eut 403-505 [21891] Other proteins in same PDB: d1eut_2, d1eut_3 complexed with na |
PDB Entry: 1eut (more details), 2.5 Å
SCOP Domain Sequences for d1eut_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eut_1 b.1.18.2 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens} gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
Timeline for d1eut_1: