Lineage for d1eut_1 (1eut 403-505)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9753Protein Sialidase, "linker" domain [49237] (1 species)
  7. 9754Species Micromonospora viridifaciens [TaxId:1881] [49238] (2 PDB entries)
  8. 9755Domain d1eut_1: 1eut 403-505 [21891]
    Other proteins in same PDB: d1eut_2, d1eut_3

Details for d1eut_1

PDB Entry: 1eut (more details), 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose

SCOP Domain Sequences for d1eut_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eut_1 b.1.1.5 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d1eut_1:

Click to download the PDB-style file with coordinates for d1eut_1.
(The format of our PDB-style files is described here.)

Timeline for d1eut_1: