Lineage for d1eqzg_ (1eqz G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311738Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (6 PDB entries)
    Uniprot P84229
  8. 2311746Domain d1eqzg_: 1eqz G: [16457]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_
    protein/DNA complex; complexed with cac, cl, k, mn

Details for d1eqzg_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
PDB Compounds: (G:) protein (histone h3)

SCOPe Domain Sequences for d1eqzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzg_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
prkqlatkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreia
qdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1eqzg_:

Click to download the PDB-style file with coordinates for d1eqzg_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzg_: