Lineage for d1eova2 (1eov A:205-557)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) 
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries) 
Domain d1eova2: 1eov A:205-557 [40760]
Other proteins in same PDB: d1eova1
Details for d1eova2
PDB Entry: 1eov (more details), 2.3 Å
PDB Description: free aspartyl-trna synthetase (asprs) (e.c. 6.1.1.12) from yeast
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASESCOPe Domain Sequences for d1eova2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp
SCOPe Domain Coordinates for d1eova2:
Click to download the PDB-style file with coordinates for d1eova2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eova2:
- d1eova2 first appeared (with stable ids) in SCOP 1.55
- d1eova2 appears in SCOPe 2.02
- d1eova2 appears in SCOPe 2.04
- d1eova2 appears in the current release, SCOPe 2.08
View in 3D
