Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries) Uniprot P01556 22-124 |
Domain d1eeid_: 1eei D: [24985] complexed with gaa |
PDB Entry: 1eei (more details), 2 Å
SCOPe Domain Sequences for d1eeid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeid_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1eeid_:
View in 3D Domains from other chains: (mouse over for more information) d1eeie_, d1eeif_, d1eeig_, d1eeih_ |