Lineage for d1e8ya1 (1e8y A:525-725)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500710Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1500711Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1500712Species Human (Homo sapiens) [TaxId:9606] [48402] (57 PDB entries)
  8. 1500713Domain d1e8ya1: 1e8y A:525-725 [19152]
    Other proteins in same PDB: d1e8ya2, d1e8ya3, d1e8ya4

Details for d1e8ya1

PDB Entry: 1e8y (more details), 2 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e8ya1:

Sequence, based on SEQRES records: (download)

>d1e8ya1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d1e8ya1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d1e8ya1:

Click to download the PDB-style file with coordinates for d1e8ya1.
(The format of our PDB-style files is described here.)

Timeline for d1e8ya1: