Lineage for d1e6yc_ (1e6y C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561885Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2561886Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2561919Species Methanosarcina barkeri [TaxId:2208] [55093] (1 PDB entry)
  8. 2561920Domain d1e6yc_: 1e6y C: [39441]
    Other proteins in same PDB: d1e6ya1, d1e6ya2, d1e6yb1, d1e6yb2, d1e6yd1, d1e6yd2, d1e6ye1, d1e6ye2
    complexed with com, f43, gol, tp7

Details for d1e6yc_

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri
PDB Compounds: (C:) methyl-coenzyme m reductase subunit gamma

SCOPe Domain Sequences for d1e6yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6yc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanosarcina barkeri [TaxId: 2208]}
ayerqyypgatsvaanrrkhmsgkleklreisdedltavlghrapgsdypsthpplaemg
epacstrenvaatpgaaagdrvryiqfadsmynapatpyfrsyfaainfrgvdpgtlsgr
qivearerdmeqcakvqmeteitdhalagvrgatvhghsvrlqedgvmfdmldrrrleng
tiimdkdqvaipldrkvdlgkpmsseeaakrttiyrvdnvafrddaevvewvhrifdqrt
kfgfqpk

SCOPe Domain Coordinates for d1e6yc_:

Click to download the PDB-style file with coordinates for d1e6yc_.
(The format of our PDB-style files is described here.)

Timeline for d1e6yc_: