Lineage for d1ckra_ (1ckr A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336001Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 1336002Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 1336003Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 1336007Protein DnaK [100922] (3 species)
  7. 1336020Species Norway rat (Rattus norvegicus) [TaxId:10116] [56782] (2 PDB entries)
  8. 1336022Domain d1ckra_: 1ckr A: [43321]

Details for d1ckra_

PDB Entry: 1ckr (more details)

PDB Description: high resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
PDB Compounds: (A:) heat shock substrate binding domain of hsc-70

SCOPe Domain Sequences for d1ckra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckra_ b.130.1.1 (A:) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
ndkgrlskediermvqeaekykaedekqrdkvssknsle

SCOPe Domain Coordinates for d1ckra_:

Click to download the PDB-style file with coordinates for d1ckra_.
(The format of our PDB-style files is described here.)

Timeline for d1ckra_: