Lineage for d1bs0a_ (1bs0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2503903Protein PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) [53436] (1 species)
  7. 2503904Species Escherichia coli [TaxId:562] [53437] (3 PDB entries)
  8. 2503905Domain d1bs0a_: 1bs0 A: [34490]
    complexed with so4

Details for d1bs0a_

PDB Entry: 1bs0 (more details), 1.65 Å

PDB Description: plp-dependent acyl-coa synthase
PDB Compounds: (A:) protein (8-amino-7-oxonanoate synthase)

SCOPe Domain Sequences for d1bs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]}
swqekinaaldarraadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtairpptvpagtarlr
ltltaahemqdidrllevlhgng

SCOPe Domain Coordinates for d1bs0a_:

Click to download the PDB-style file with coordinates for d1bs0a_.
(The format of our PDB-style files is described here.)

Timeline for d1bs0a_: