Lineage for d1bkza_ (1bkz A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein Galectin-7 [100926] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries) 
Domain d1bkza_: 1bkz A: [24202]
Details for d1bkza_
PDB Entry: 1bkz (more details), 1.9 Å
PDB Description: crystal structure of human galectin-7
PDB Compounds: (A:) galectin-7SCOPe Domain Sequences for d1bkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkza_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif
SCOPe Domain Coordinates for d1bkza_:
Click to download the PDB-style file with coordinates for d1bkza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bkza_:
View in 3D
