Lineage for d1biza_ (1biz A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this fold
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Protein Retroviral integrase, catalytic domain [53108] (4 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) 
Domain d1biza_: 1biz A: [33652]
complexed with cac
Details for d1biza_
PDB Entry: 1biz (more details), 1.95 Å
PDB Description: hiv-1 integrase core domain
PDB Compounds: (A:) hiv-1 integraseSCOPe Domain Sequences for d1biza_:
Sequence, based on SEQRES records: (download)
>d1biza_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
vdsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktv
htdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlk
tavqmavfihnkkrkggiggysagerivdiiatdi
Sequence, based on observed residues (ATOM records): (download)
>d1biza_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
vdsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktv
htdngsnftsttvkaacwwagikqefggviesmnkelkkiigqvrdqaehlktavqmavf
ihnkkrkggiggysagerivdiiatdi
SCOPe Domain Coordinates for d1biza_:
Click to download the PDB-style file with coordinates for d1biza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1biza_:
View in 3D
