Lineage for d1ayg__ (1ayg -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532347Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 532348Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 532349Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 532429Protein Cytochrome c552 [46636] (5 species)
  7. 532430Species Hydrogenobacter thermophilus [TaxId:940] [46640] (1 PDB entry)
  8. 532431Domain d1ayg__: 1ayg - [15831]
    complexed with hec

Details for d1ayg__

PDB Entry: 1ayg (more details)

PDB Description: solution structure of cytochrome c-552, nmr, 20 structures

SCOP Domain Sequences for d1ayg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayg__ a.3.1.1 (-) Cytochrome c552 {Hydrogenobacter thermophilus}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

SCOP Domain Coordinates for d1ayg__:

Click to download the PDB-style file with coordinates for d1ayg__.
(The format of our PDB-style files is described here.)

Timeline for d1ayg__: