SCOP 1.73: Domain d1ayga_: 1ayg A:

Lineage for d1ayga_ (1ayg A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (3 PDB entries)

8. Domain d1ayga_: 1ayg A: [15831]
   complexed with hec

Details for d1ayga_

PDB Entry: 1ayg

PDB Description: solution structure of cytochrome c-552, nmr, 20 structures

PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d1ayga_:

Sequence; same for both SEQRES and ATOM records:

>d1ayga_ a.3.1.1 (A:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

Timeline for d1ayga_:

• d1ayga_ first appeared (with stable ids) in SCOP 1.55, called d1ayg__
  
• d1ayga_ was called d1ayg__ in SCOP 1.71
  
• d1ayga_ appears in SCOP 1.75
  
• d1ayga_ appears in the current release, SCOPe 2.08