Lineage for d1atra1 (1atr A:2-188)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605292Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1605293Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 1605360Domain d1atra1: 1atr A:2-188 [33421]
    complexed with adp, mg, po4

Details for d1atra1

PDB Entry: 1atr (more details), 2.34 Å

PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis
PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOPe Domain Sequences for d1atra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atra1 c.55.1.1 (A:2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
aygldkk

SCOPe Domain Coordinates for d1atra1:

Click to download the PDB-style file with coordinates for d1atra1.
(The format of our PDB-style files is described here.)

Timeline for d1atra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1atra2