Lineage for d1atra1 (1atr A:2-188)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) 
Domain d1atra1: 1atr A:2-188 [33421]
complexed with adp, mg, po4
Details for d1atra1
PDB Entry: 1atr (more details), 2.34 Å
PDB Description: threonine 204 of the chaperone protein hsc70 influences the structure of the active site but is not essential for atp hydrolysis
PDB Compounds: (A:) heat-shock cognate 70 kd proteinSCOPe Domain Sequences for d1atra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atra1 c.55.1.1 (A:2-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
skgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvam
nptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevss
mvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaai
aygldkk
SCOPe Domain Coordinates for d1atra1:
Click to download the PDB-style file with coordinates for d1atra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1atra1:
- d1atra1 first appeared (with stable ids) in SCOP 1.55, called d1atr_1
- d1atra1 appears in SCOPe 2.02
- d1atra1 appears in SCOPe 2.04
- d1atra1 appears in the current release, SCOPe 2.08
View in 3D
