Lineage for d1aeya_ (1aey A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [50059] (34 PDB entries)
  8. 1536164Domain d1aeya_: 1aey A: [24496]

Details for d1aeya_

PDB Entry: 1aey (more details)

PDB Description: alpha-spectrin src homology 3 domain, solution nmr, 15 structures
PDB Compounds: (A:) alpha-spectrin

SCOPe Domain Sequences for d1aeya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeya_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOPe Domain Coordinates for d1aeya_:

Click to download the PDB-style file with coordinates for d1aeya_.
(The format of our PDB-style files is described here.)

Timeline for d1aeya_: