PDB entry 7nes

View 7nes on RCSB PDB site
Description: Crystal structure of the v-Src SH3 domain N117D-V124L mutant
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2021-02-04, released 2021-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: v-Src SH3 domain
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • PDB 7NES
  Domains in SCOPe 2.07: d7nesa_
• Heterogens: GLY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7nesA (A:)
  ggvttfvalydyeswietdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
  d
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7nesA (A:)
  vttfvalydyeswietdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps