PDB entry 7ner

View 7ner on RCSB PDB site
Description: Crystal structure of the v-Src SH3 domain Q128R mutant
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2021-02-04, released 2021-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v-Src SH3 domain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 7NER (0-End)
    Domains in SCOPe 2.07: d7nera_
  • Heterogens: PG4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7nerA (A:)
    ggvttfvalydyeswietdlsfkkgerlqivnntegnwwlahsvttgrtgyipsnyvaps
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >7nerA (A:)
    ggvttfvalydyeswietdlsfkkgerlqivnntegnwwlahsvttgrtgyipsnyvaps