SCOPe 2.07: Structural Classification of Proteins

PDB entry 7jso

View 7jso on RCSB PDB site
Description: P. syringae AldA Indole-3-Acetaldehyde Dehydrogenase C302A mutant in complex with NAD+ and IAA
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, auxin, OXIDOREDUCTASE
Deposited on 2020-08-15, released 2021-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsoa_
Chain 'B':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsob_
Chain 'C':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsoc_
Chain 'D':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsod_
Chain 'E':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsoe_
Chain 'F':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsof_
Chain 'G':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsog_
Chain 'H':
Compound: Aldehyde dehydrogenase family protein
Species: Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) [TaxId:223283]
Gene: PSPTO_0092
Database cross-references and differences (RAF-indexed):
- Uniprot Q88BC5 (Start-496)
  - engineered mutation (301)
Domains in SCOPe 2.07: d7jsoh_
Heterogens: NAI, IAC

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>7jsoA (A:)
mttltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaq
ravesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvd
ipggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgp
alstgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtv
vftgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqge
vatagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaag
htdgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiq
iandtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdks
lhafdkytelkstwikl