PDB entry 7cat

View 7cat on RCSB PDB site
Description: The NADPH binding site on beef liver catalase
Class: oxidoreductase
Keywords: oxidoreductase, h2o2 acceptor
Deposited on 1984-11-15, released 1985-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7cata_
  • Chain 'B':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7catb_
  • Heterogens: HEM, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7catA (A:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >7catA (A:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7catB (B:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >7catB (B:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyn