SCOPe 2.07: Structural Classification of Proteins

PDB entry 6zh5

View 6zh5 on RCSB PDB site
Description: Folding of an iron binding peptide in response to sedimentation is resolved using ferritin as a nano-reactor
Class: metal binding protein
Keywords: Biomineralization, nano-reactor, radiation damage assisted single-particle analysis, METAL BINDING PROTEIN
Deposited on 2020-06-21, released 2021-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: EM
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5a1, d6zh5a2
Chain 'B':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5b1, d6zh5b2
Chain 'C':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5c1, d6zh5c2
Chain 'D':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5d1, d6zh5d2
Chain 'E':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5e1, d6zh5e2
Chain 'F':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5f1, d6zh5f2
Chain 'G':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5g1, d6zh5g2
Chain 'H':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5h1, d6zh5h2
Chain 'I':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5i1, d6zh5i2
Chain 'J':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5j1, d6zh5j2
Chain 'K':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5k1, d6zh5k2
Chain 'L':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5l1, d6zh5l2
Chain 'M':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5m1, d6zh5m2
Chain 'N':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5n1, d6zh5n2
Chain 'O':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5o1, d6zh5o2
Chain 'P':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5p1, d6zh5p2
Chain 'Q':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5q1, d6zh5q2
Chain 'R':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5r1, d6zh5r2
Chain 'S':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5s1, d6zh5s2
Chain 'T':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5t1, d6zh5t2
Chain 'U':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5u1, d6zh5u2
Chain 'V':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5v1, d6zh5v2
Chain 'W':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5w1, d6zh5w2
Chain 'Z':
Compound: Ferritin
Species: Mus musculus [TaxId:10090]
Gene: Ftl1, Ftl1-ps1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9CPX4 (Start-202)
  - expression tag (203-210)
Domains in SCOPe 2.07: d6zh5z1, d6zh5z2
Heterogens: FE

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6zh5A (A:)
mgsshhhhhhssglvprgshmtsqirqnysteveaavnrlvnlhlrasytylslgfffdr
ddvalegvghffrelaeekregaerllefqndrggralfqdvqkpsqdewgktqeameaa
lameknlnqalldlhalgsaradphlcdfleshyldkevklikkmgnhltnlrrvagpqp
aqtgapqgslgeylferltlkhdgdiesaqsdeeve