PDB entry 6yw8

View 6yw8 on RCSB PDB site
Description: NMR solution structure of unbound recombinant human Nerve Growth Factor (rhNGF)
Class: hormone
Keywords: human NGF, unbound structure, homodimer, cystin-knot, HORMONE
Deposited on 2020-04-29, released 2021-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6yw8a_
  • Chain 'B':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6yw8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yw8A (A:)
ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yw8B (B:)
ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr