PDB entry 6xvn

View 6xvn on RCSB PDB site
Description: Crystal structure of c-Src SH3 domain without ATCUN motif: monomer 1
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-01-22, released 2020-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xvna_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xvnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6xvnA (A:)
mgsshhhhhhssgpqqglrgvttfvalydyesrtetdlsfkkgerlqivnntegdwwlah
slttgqtgyipsnyvapsd

    Sequence, based on observed residues (ATOM records): (download) 
    >6xvnA (A:)
gvttfvalydyesrtetdlsfkkgerlqivntegdwwlahslttgqtgyipsnyvapsd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6xvnB (B:)
mgsshhhhhhssgpqqglrgvttfvalydyesrtetdlsfkkgerlqivnntegdwwlah
slttgqtgyipsnyvapsd

    Sequence, based on observed residues (ATOM records): (download) 
    >6xvnB (B:)
gvttfvalydyesrtetdlsfkkgerlqivngdwwlahslttgqtgyipsnyvapsd