PDB entry 6rz0

View 6rz0 on RCSB PDB site
Description: Crystal structure of Escherichia coli Glyoxalase II
Class: hydrolase
Keywords: Metallo-beta-lactamase, metal-ion-binding, Glyoxalase II (hydroxyacylglutathione hydrolase), Ribonuclease Z/Hydroxyacylglutathione hydrolase-like, HYDROLASE
Deposited on 2019-06-12, released 2020-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxyacylglutathione hydrolase GloB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: gloB, yafR, b0212, JW0202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6rz0a_
  • Heterogens: GOL, ZN, CXS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6rz0A (A:)
mnlnsipafddnyiwvlndeagrclivdpgdaepvlnaiaannwqpeaiflthhhhdhvg
gvkelvekfpqivvygpqetqdkgttqvvkdgetafvlghefsviatpghtlghicyfsk
pylfcgdtlfsggcgrlfegtasqmyqslkklsalpddtlvccaheytlsnmkfalsilp
hdlsindyyrkvkelraknqitlpvilknerqinvflrtedidlinvineetllqqpeer
fawlrskkdrf